Lineage for d1xrtb1 (1xrt B:1-55,B:366-422)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819141Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2819142Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2819203Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)
  6. 2819259Protein Two-domain dihydroorotase [141686] (1 species)
  7. 2819260Species Aquifex aeolicus [TaxId:63363] [141687] (2 PDB entries)
    Uniprot O66990 1-55,366-422
  8. 2819262Domain d1xrtb1: 1xrt B:1-55,B:366-422 [122260]
    Other proteins in same PDB: d1xrta2, d1xrtb2, d1xrtb3
    automated match to d1xrfa1
    complexed with zn

Details for d1xrtb1

PDB Entry: 1xrt (more details), 1.61 Å

PDB Description: The Crystal Structure of a Novel, Latent Dihydroorotase from Aquifex Aeolicus at 1.7 A Resolution
PDB Compounds: (B:) dihydroorotase

SCOPe Domain Sequences for d1xrtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrtb1 b.92.1.3 (B:1-55,B:366-422) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]}
mlklivkngyvidpsqnlegefdilvengkikkidknilvpeaeiidakglivcpXtlkl
gspaditifdpnkewilneetnlsksrntplwgkvlkgkviytikdgkmvykd

SCOPe Domain Coordinates for d1xrtb1:

Click to download the PDB-style file with coordinates for d1xrtb1.
(The format of our PDB-style files is described here.)

Timeline for d1xrtb1: