Lineage for d1xrta2 (1xrt A:56-365)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 proteins)
    automatically mapped to Pfam PF13147
  6. Protein Two-domain dihydroorotase [141803] (1 species)
  7. Species Aquifex aeolicus [TaxId:63363] [141804] (2 PDB entries)
    Uniprot O66990 56-365
  8. Domain d1xrta2: 1xrt A:56-365 [122259]
    Other proteins in same PDB: d1xrta1, d1xrtb1, d1xrtb3
    automated match to d1xrfa2
    complexed with zn

Details for d1xrta2

PDB Entry: 1xrt (more details), 1.61 Å

PDB Description: The Crystal Structure of a Novel, Latent Dihydroorotase from Aquifex Aeolicus at 1.7 A Resolution
PDB Compounds: (A:) dihydroorotase

SCOPe Domain Sequences for d1xrta2:

Sequence, based on SEQRES records: (download)

>d1xrta2 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]}
gfidihvhlrdpgqtykediesgsrcavaggfttivcmpntnppidnttvvnyilqksks
vglcrvlptgtitkgrkgkeiadfyslkeagcvaftddgspvmdssvmrkalelasqlgv
pimdhceddklaygvinegevsallglssrapeaeeiqiardgilaqrtgghvhiqhvst
klsleiieffkekgvkitcevnpnhllfterevlnsganarvnpplrkkedrlaliegvk
rgiidcfatdhaphqtfekelvefampgiiglqtalpsalelyrkgiislkkliemftin
pariigvdlg

Sequence, based on observed residues (ATOM records): (download)

>d1xrta2 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]}
gfidihvhlrdpgqtykediesgsrcavaggfttivcmpntnppidnttvvnyilqksks
vglcrvlptgtitkgrkgkeiadfyslkeagcvaftddgspvmdssvmrkalelasqlgv
pimdhceddklayaeeiqiardgilaqrtgghvhiqhvstklsleiieffkekgvkitce
vnpnhlledrlaliegvkrgiidcfatdhaphqtgiiglqtalpsalelyrkgiislkkl
iemftinpariigvdlg

SCOPe Domain Coordinates for d1xrta2 are not available.

Timeline for d1xrta2:

Domains from same chain:
(mouse over for more information)
d1xrta1
Domains from other chains:
(mouse over for more information)
d1xrtb1, d1xrtb2, d1xrtb3