Lineage for d1xl3b_ (1xl3 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.243: Type III secretion system domain [140590] (1 superfamily)
    core: 4 helices, orthogonal array; right-handed superhelix
  4. Superfamily a.243.1: Type III secretion system domain [140591] (3 families) (S)
  5. Family a.243.1.3: LcrE-like [140598] (1 protein)
    Duplication; contains two domains of this fold; Pfam PF07201 (HrpJ-like) covers the first domain and the N-terminal half of the second domain
  6. Protein Outer membrane protein yopN (LcrE) [140599] (1 species)
  7. Species Yersinia pestis [TaxId:632] [140600] (2 PDB entries)
    Uniprot P68640 73-269! Uniprot P68640 78-283
  8. Domain d1xl3b_: 1xl3 B: [122103]
    Other proteins in same PDB: d1xl3c1, d1xl3d_
    automated match to d1xl3a1

Details for d1xl3b_

PDB Entry: 1xl3 (more details), 2.2 Å

PDB Description: Complex structure of Y.pestis virulence Factors YopN and TyeA
PDB Compounds: (B:) Secretion control protein

SCOPe Domain Sequences for d1xl3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl3b_ a.243.1.3 (B:) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]}
arvsdveeqvnqylskvpeleqkqnvsellsllsnspnislsqlkaylegkseepseqfk
mlcglrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgvnplqp
lrdtyrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgreklgi
visdlqklkefgsvsdqvkgfwqffs

SCOPe Domain Coordinates for d1xl3b_ are not available.

Timeline for d1xl3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xl3a1, d1xl3c1, d1xl3d_