![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.243: Type III secretion system domain [140590] (1 superfamily) core: 4 helices, orthogonal array; right-handed superhelix |
![]() | Superfamily a.243.1: Type III secretion system domain [140591] (3 families) ![]() |
![]() | Family a.243.1.3: LcrE-like [140598] (1 protein) Duplication; contains two domains of this fold; Pfam PF07201 (HrpJ-like) covers the first domain and the N-terminal half of the second domain |
![]() | Protein Outer membrane protein yopN (LcrE) [140599] (1 species) |
![]() | Species Yersinia pestis [TaxId:632] [140600] (2 PDB entries) Uniprot P68640 73-269! Uniprot P68640 78-283 |
![]() | Domain d1xl3b_: 1xl3 B: [122103] Other proteins in same PDB: d1xl3c1, d1xl3d_ automated match to d1xl3a1 |
PDB Entry: 1xl3 (more details), 2.2 Å
SCOPe Domain Sequences for d1xl3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xl3b_ a.243.1.3 (B:) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]} arvsdveeqvnqylskvpeleqkqnvsellsllsnspnislsqlkaylegkseepseqfk mlcglrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgvnplqp lrdtyrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgreklgi visdlqklkefgsvsdqvkgfwqffs
Timeline for d1xl3b_: