Lineage for d1xl3d_ (1xl3 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738120Fold a.243: Type III secretion system domain [140590] (1 superfamily)
    core: 4 helices, orthogonal array; right-handed superhelix
  4. 2738121Superfamily a.243.1: Type III secretion system domain [140591] (3 families) (S)
  5. 2738122Family a.243.1.1: TyeA-like [140592] (1 protein)
    Pfam PF09059
  6. 2738123Protein TyeA [140593] (1 species)
  7. 2738124Species Yersinia pestis [TaxId:632] [140594] (1 PDB entry)
    Uniprot P69968 2-92
  8. 2738126Domain d1xl3d_: 1xl3 D: [122105]
    Other proteins in same PDB: d1xl3a1, d1xl3b_
    automated match to d1xl3c1

Details for d1xl3d_

PDB Entry: 1xl3 (more details), 2.2 Å

PDB Description: Complex structure of Y.pestis virulence Factors YopN and TyeA
PDB Compounds: (D:) protein type A

SCOPe Domain Sequences for d1xl3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl3d_ a.243.1.1 (D:) TyeA {Yersinia pestis [TaxId: 632]}
aydlsefmgdivalvdkrwagihdiehlanafslptpeikvrfyqdlkrmfrlfplgvfs
deeqrqnllqmcqnaidmaieseee

SCOPe Domain Coordinates for d1xl3d_:

Click to download the PDB-style file with coordinates for d1xl3d_.
(The format of our PDB-style files is described here.)

Timeline for d1xl3d_: