Lineage for d1xl3b1 (1xl3 B:78-283)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651638Fold a.243: Type III secretion system domain [140590] (1 superfamily)
    core: 4 helices, orthogonal array; right-handed superhelix
  4. 651639Superfamily a.243.1: Type III secretion system domain [140591] (3 families) (S)
  5. 651649Family a.243.1.3: LcrE-like [140598] (1 protein)
    Duplication; contains two domains of this fold; Pfam PF07201 (HrpJ-like) covers the first domain and the N-terminal half of the second domain
  6. 651650Protein Outer membrane protein yopN (LcrE) [140599] (1 species)
  7. 651651Species Yersinia pestis [TaxId:632] [140600] (2 PDB entries)
  8. 651654Domain d1xl3b1: 1xl3 B:78-283 [122103]
    Other proteins in same PDB: d1xl3c1, d1xl3d1
    automatically matched to 1XL3 A:78-283
    complexed with mly; mutant

Details for d1xl3b1

PDB Entry: 1xl3 (more details), 2.2 Å

PDB Description: Complex structure of Y.pestis virulence Factors YopN and TyeA
PDB Compounds: (B:) Secretion control protein

SCOP Domain Sequences for d1xl3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl3b1 a.243.1.3 (B:78-283) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]}
arvsdveeqvnqylskvpeleqkqnvsellsllsnspnislsqlkaylegkseepseqfk
mlcglrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgvnplqp
lrdtyrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgreklgi
visdlqklkefgsvsdqvkgfwqffs

SCOP Domain Coordinates for d1xl3b1:

Click to download the PDB-style file with coordinates for d1xl3b1.
(The format of our PDB-style files is described here.)

Timeline for d1xl3b1: