Class a: All alpha proteins [46456] (290 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins) automatically mapped to Pfam PF01126 |
Protein Heme oxygenase-1 (HO-1) [48615] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries) Uniprot P09601 |
Domain d1xk1b_: 1xk1 B: [122054] automated match to d1ni6c_ complexed with hem; mutant |
PDB Entry: 1xk1 (more details), 2.08 Å
SCOPe Domain Sequences for d1xk1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xk1b_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]} pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell vahaytrylgdlshgqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyesrmnsl emtpavrqrvieeaktafllniqlfeelqellth
Timeline for d1xk1b_: