PDB entry 1xk1

View 1xk1 on RCSB PDB site
Description: Crystal Structures of the G139A, G139A-NO and G143H Mutants of Human Heme Oxygenase-1
Class: oxidoreductase
Keywords: heme, heme degredation, OXIDOREDUCTASE
Deposited on 2004-09-26, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.271
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO1, HO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09601
      • engineered (142)
      • conflict (182)
    Domains in SCOPe 2.07: d1xk1a1
  • Chain 'B':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1, HO1, HO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09601
      • engineered (142)
      • conflict (182)
    Domains in SCOPe 2.07: d1xk1b_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xk1A (A:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlshgqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyesrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk1A (A:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlshgqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyesrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xk1B (B:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlshgqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyesrmnslemtpavrqrvieeaktafllniqlfeelqellthdtkdqspsra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xk1B (B:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlshgqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyesrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth