SCOPe 2.08: Domain d1xk1a1: 1xk1 A:10-223

Lineage for d1xk1a1 (1xk1 A:10-223)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
   Uniprot P09601

8. Domain d1xk1a1: 1xk1 A:10-223 [122053]
   complexed with hem; mutant

Details for d1xk1a1

PDB Entry: 1xk1, 2.08 Å

PDB Description: crystal structures of the g139a, g139a-no and g143h mutants of human heme oxygenase-1

PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d1xk1a1:

Sequence; same for both SEQRES and ATOM records:

>d1xk1a1 a.132.1.1 (A:10-223) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlshgqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyesrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1xk1a1:

• d1xk1a1 first appeared in SCOP 1.73
  
• d1xk1a1 appears in SCOPe 2.07