Lineage for d1xdld_ (1xdl D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2085157Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2085377Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. 2085383Species Human (Homo sapiens) [TaxId:9606] [254964] (2 PDB entries)
  8. 2085394Domain d1xdld_: 1xdl D: [121875]
    automated match to d1fdja_
    complexed with so4

Details for d1xdld_

PDB Entry: 1xdl (more details), 3 Å

PDB Description: Structure of human aldolase B associated with hereditary fructose intolerance (A149P), at 277K
PDB Compounds: (D:) Fructose-bisphosphate aldolase B

SCOPe Domain Sequences for d1xdld_:

Sequence, based on SEQRES records: (download)

>d1xdld_ c.1.10.1 (D:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens) [TaxId: 9606]}
altqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfsv
dssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagtnkettiq
gldglsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicqqnglvpi
vepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtaghactkkytp
eqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwklsfsygral
qasalaawggkaankeatqeafmkramancqaakgqyvht

Sequence, based on observed residues (ATOM records): (download)

>d1xdld_ c.1.10.1 (D:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens) [TaxId: 9606]}
altqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfsv
dssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldgldglsercaqykkdg
vdfgkwrsslaiqenanalaryasicqqnglvpivepevhcqyvtekvlaavykalndhh
vylegtllkpnmvtytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainl
cplpkpwklsfsygralqasalaawggkaankeatqeafmkramancqaakgqyvht

SCOPe Domain Coordinates for d1xdld_:

Click to download the PDB-style file with coordinates for d1xdld_.
(The format of our PDB-style files is described here.)

Timeline for d1xdld_: