PDB entry 1xdl

View 1xdl on RCSB PDB site
Description: Structure of human aldolase B associated with hereditary fructose intolerance (A149P), at 277K
Class: lyase
Keywords: alpha/beta barrel, lyase
Deposited on 2004-09-07, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.304
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase B
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDOB, ALDB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05062
      • engineered (150)
    Domains in SCOPe 2.07: d1xdla1
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase B
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDOB, ALDB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xdlb_
  • Chain 'C':
    Compound: Fructose-bisphosphate aldolase B
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDOB, ALDB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05062
      • engineered (150)
    Domains in SCOPe 2.07: d1xdlc_
  • Chain 'D':
    Compound: Fructose-bisphosphate aldolase B
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDOB, ALDB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xdld_
  • Chain 'W':
    Compound: Fructose-bisphosphate aldolase B
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDOB, ALDB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xdlw_
  • Chain 'X':
    Compound: Fructose-bisphosphate aldolase B
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDOB, ALDB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05062
      • engineered (150)
    Domains in SCOPe 2.07: d1xdlx_
  • Chain 'Y':
    Compound: Fructose-bisphosphate aldolase B
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDOB, ALDB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05062
      • engineered (150)
    Domains in SCOPe 2.07: d1xdly_
  • Chain 'Z':
    Compound: Fructose-bisphosphate aldolase B
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDOB, ALDB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05062
      • engineered (150)
    Domains in SCOPe 2.07: d1xdlz_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xdlA (A:)
    gsahrfpaltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqf
    reilfsvdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagt
    nkettiqgldglsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicq
    qnglvpivepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtagha
    ctkkytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwkls
    fsygralqasalaawggkaankeatqeafmkramancqaakgqyvhtgssgaastqslft
    acyty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdlA (A:)
    altqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfsv
    dssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqgldglsercaqykkd
    gvdfgkwrpvlrsslaiqenanalaryasicqqnglvpivepevipehcqyvtekvlaav
    ykalndhhvylegtllkpnmvtytpeqvamatvtalhrtvpaavpgicflsggmseedat
    lnlnainlcplpkpwklsfsygralqasalaawggkaankeatqeafmkramancqaakg
    qyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xdlB (B:)
    gsahrfpaltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqf
    reilfsvdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagt
    nkettiqgldglsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicq
    qnglvpivepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtagha
    ctkkytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwkls
    fsygralqasalaawggkaankeatqeafmkramancqaakgqyvhtgssgaastqslft
    acyty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdlB (B:)
    fpaltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilf
    svdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldgldglsercaqykk
    dgvdfgkwrsslaiqenanalaryasicqqnglvpivepehcqyvtekvlaavykalndh
    hvylegtllkpnmvtaytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnai
    nlcplpkpwklsfsygralqasalaawggkaankeatqeafmkramancqaakgqyvht
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xdlC (C:)
    gsahrfpaltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqf
    reilfsvdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagt
    nkettiqgldglsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicq
    qnglvpivepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtagha
    ctkkytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwkls
    fsygralqasalaawggkaankeatqeafmkramancqaakgqyvhtgssgaastqslft
    acyty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdlC (C:)
    altqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfsv
    dssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldplagtnkettiqgldg
    lsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicqqnglvpivepe
    vipdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtatkkytpeqvamatvta
    lhrtvpaavpgicflsggmseedatlnlnainlcplpkpwklsfsygralqasalaawgg
    kaankeatqeafmkramancqaakgqyvh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xdlD (D:)
    gsahrfpaltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqf
    reilfsvdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagt
    nkettiqgldglsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicq
    qnglvpivepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtagha
    ctkkytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwkls
    fsygralqasalaawggkaankeatqeafmkramancqaakgqyvhtgssgaastqslft
    acyty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdlD (D:)
    altqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfsv
    dssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldgldglsercaqykkdg
    vdfgkwrsslaiqenanalaryasicqqnglvpivepevhcqyvtekvlaavykalndhh
    vylegtllkpnmvtytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainl
    cplpkpwklsfsygralqasalaawggkaankeatqeafmkramancqaakgqyvht
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1xdlW (W:)
    gsahrfpaltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqf
    reilfsvdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagt
    nkettiqgldglsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicq
    qnglvpivepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtagha
    ctkkytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwkls
    fsygralqasalaawggkaankeatqeafmkramancqaakgqyvhtgssgaastqslft
    acyty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdlW (W:)
    altqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfsv
    dssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldgldglsercaqykkdg
    vdfgkwrsslaiqenanalaryasicqqnglvpivepdlehcqyvtekvlaavykalndh
    hvylegtllkpnmvtytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnain
    lcplpkpwklsfsygralqasalaawggkaankeatqeafmkramancqaakgqyv
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1xdlX (X:)
    gsahrfpaltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqf
    reilfsvdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagt
    nkettiqgldglsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicq
    qnglvpivepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtagha
    ctkkytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwkls
    fsygralqasalaawggkaankeatqeafmkramancqaakgqyvhtgssgaastqslft
    acyty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdlX (X:)
    paltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfs
    vdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqlagtnkettiqgld
    glsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicqqnglvpivep
    evipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtaytpeqvamatvta
    lhrtvpaavpgicflsggmseedatlnlnainlcplpkpwklsfsygralqasalaawgg
    kaankeatqeafmkramancqaakgqyvh
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1xdlY (Y:)
    gsahrfpaltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqf
    reilfsvdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagt
    nkettiqgldglsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicq
    qnglvpivepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtagha
    ctkkytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwkls
    fsygralqasalaawggkaankeatqeafmkramancqaakgqyvhtgssgaastqslft
    acyty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdlY (Y:)
    paltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfs
    vdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldgldglsercaqykkd
    gvdfgkwrpvsslaiqenanalaryasicqqnglvpivepelehcqyvtekvlaavykal
    ndhhvylegtllkpnmvtaytpeqvamatvtalhrtvpaavpgicflsggmseedatlnl
    nainlcplpkpwklsfsygralqasalaawggkaankeatqeafmkramancqaakgqyv
    ht
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1xdlZ (Z:)
    gsahrfpaltqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqf
    reilfsvdssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldqggaplagt
    nkettiqgldglsercaqykkdgvdfgkwrpvlriadqcpsslaiqenanalaryasicq
    qnglvpivepevipdgdhdlehcqyvtekvlaavykalndhhvylegtllkpnmvtagha
    ctkkytpeqvamatvtalhrtvpaavpgicflsggmseedatlnlnainlcplpkpwkls
    fsygralqasalaawggkaankeatqeafmkramancqaakgqyvhtgssgaastqslft
    acyty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xdlZ (Z:)
    altqeqkkelseiaqsivangkgilaadesvgtmgnrlqrikventeenrrqfreilfsv
    dssinqsiggvilfhetlyqkdsqgklfrnilkekgivvgikldgldglsercaqykkdg
    vdfgkwrpvlrislaiqenanalaryasicqqnglvpivepevdlehcqyvtekvlaavy
    kalndhhvylegtllkpnmvtytpeqvamatvtalhrtvpaavpgicflsggmseedatl
    nlnainlcplpkpwklsfsygralqasalaawggkaankeatqeafmkramancqaakgq
    y