![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.2: IPP isomerase-like [64369] (4 proteins) |
![]() | Protein Isopentenyl diphosphate isomerase [64370] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [64371] (18 PDB entries) Uniprot Q46822 |
![]() | Domain d1x84b2: 1x84 B:4-182 [121796] Other proteins in same PDB: d1x84b3 automated match to d1nfsb_ complexed with mg, mn, sbh |
PDB Entry: 1x84 (more details), 1.78 Å
SCOPe Domain Sequences for d1x84b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x84b2 d.113.1.2 (B:4-182) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk
Timeline for d1x84b2: