Lineage for d1x84b2 (1x84 B:4-182)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535539Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2535540Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2535778Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)
  6. 2535788Protein Isopentenyl diphosphate isomerase [64370] (2 species)
  7. 2535789Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
    Uniprot Q46822
  8. 2535797Domain d1x84b2: 1x84 B:4-182 [121796]
    Other proteins in same PDB: d1x84b3
    automated match to d1nfsb_
    complexed with mg, mn, sbh

Details for d1x84b2

PDB Entry: 1x84 (more details), 1.78 Å

PDB Description: IPP isomerase (wt) reacted with (S)-bromohydrine of IPP
PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d1x84b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x84b2 d.113.1.2 (B:4-182) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk

SCOPe Domain Coordinates for d1x84b2:

Click to download the PDB-style file with coordinates for d1x84b2.
(The format of our PDB-style files is described here.)

Timeline for d1x84b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x84b3
View in 3D
Domains from other chains:
(mouse over for more information)
d1x84a_