Lineage for d1nfsb_ (1nfs B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.113: Nudix [55810] (1 superfamily)
beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
contains beta-grasp motifSuperfamily d.113.1: Nudix [55811] (8 families) 
Family d.113.1.2: IPP isomerase-like [64369] (4 proteins) Protein Isopentenyl diphosphate isomerase [64370] (2 species) Species Escherichia coli [TaxId:562] [64371] (15 PDB entries)
Uniprot Q46822
Domain d1nfsb_: 1nfs B: [85641]
complexed with ded, mg, mn
Details for d1nfsb_
PDB Entry: 1nfs (more details), 1.96 Å
PDB Description: structure and mechanism of action of isopentenylpyrophosphate- dimethylallylpyrophosphate isomerase: complex with nipp
PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomeraseSCOPe Domain Sequences for d1nfsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfsb_ d.113.1.2 (B:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl
SCOPe Domain Coordinates for d1nfsb_:
Click to download the PDB-style file with coordinates for d1nfsb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nfsb_:
- d1nfsb_ first appeared in SCOP 1.65
- d1nfsb_ appears in SCOPe 2.04
- d1nfsb_ is called d1nfsb1 in SCOPe 2.06
- d1nfsb_ appears in the current release, SCOPe 2.08, called d1nfsb1
View in 3D
