Lineage for d1x84a_ (1x84 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971664Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)
  6. 2971674Protein Isopentenyl diphosphate isomerase [64370] (2 species)
  7. 2971675Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
    Uniprot Q46822
  8. 2971682Domain d1x84a_: 1x84 A: [121795]
    Other proteins in same PDB: d1x84b3
    automated match to d1nfsb_
    complexed with mg, mn, sbh

Details for d1x84a_

PDB Entry: 1x84 (more details), 1.78 Å

PDB Description: IPP isomerase (wt) reacted with (S)-bromohydrine of IPP
PDB Compounds: (A:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d1x84a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x84a_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft

SCOPe Domain Coordinates for d1x84a_:

Click to download the PDB-style file with coordinates for d1x84a_.
(The format of our PDB-style files is described here.)

Timeline for d1x84a_: