PDB entry 1x84

View 1x84 on RCSB PDB site
Description: IPP isomerase (wt) reacted with (S)-bromohydrine of IPP
Class: isomerase
Keywords: isomerase, complex
Deposited on 2004-08-17, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.21
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Escherichia coli [TaxId:562]
    Gene: IDI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x84a_
  • Chain 'B':
    Compound: Isopentenyl-diphosphate delta-isomerase
    Species: Escherichia coli [TaxId:562]
    Gene: IDI
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46822 (Start-181)
      • expression tag (182)
    Domains in SCOPe 2.07: d1x84b2, d1x84b3
  • Heterogens: MN, MG, SBH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x84A (A:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x84A (A:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x84B (B:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x84B (B:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl