Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Coagulation factor IXa, protease domain [50583] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50584] (2 PDB entries) |
Domain d1x7ac_: 1x7a C: [121781] Other proteins in same PDB: d1x7al1, d1x7al2 automated match to d1pfxc_ complexed with 187 |
PDB Entry: 1x7a (more details), 2.9 Å
SCOPe Domain Sequences for d1x7ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x7ac_ b.47.1.2 (C:) Coagulation factor IXa, protease domain {Pig (Sus scrofa) [TaxId: 9823]} ivggenakpgqfpwqvllngkidafcggsiinekwvvtaahciepgvkitvvageyntee tepteqrrnviraiphhsynatvnkyshdialleldepltlnsyvtpiciadkeytnifl kfgsgyvsgwgrvfnrgrsatilqylkvplvdratclrstkftiysnmfcagfheggkds cqgdsggphvtevegtsfltgiiswgeecavkgkygiytkvsryvnwikektklt
Timeline for d1x7ac_: