Lineage for d1x7ac_ (1x7a C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795087Protein Coagulation factor IXa, protease domain [50583] (2 species)
  7. 2795111Species Pig (Sus scrofa) [TaxId:9823] [50584] (2 PDB entries)
  8. 2795113Domain d1x7ac_: 1x7a C: [121781]
    Other proteins in same PDB: d1x7al1, d1x7al2
    automated match to d1pfxc_
    complexed with 187

Details for d1x7ac_

PDB Entry: 1x7a (more details), 2.9 Å

PDB Description: Porcine Factor IXa Complexed to 1-{3-[amino(imino)methyl]phenyl}-N-[4-(1H-benzimidazol-1-yl)-2-fluorophenyl]-3-(trifluoromethyl)-1H-pyrazole-5-carboxamide
PDB Compounds: (C:) Coagulation Factor IXa

SCOPe Domain Sequences for d1x7ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x7ac_ b.47.1.2 (C:) Coagulation factor IXa, protease domain {Pig (Sus scrofa) [TaxId: 9823]}
ivggenakpgqfpwqvllngkidafcggsiinekwvvtaahciepgvkitvvageyntee
tepteqrrnviraiphhsynatvnkyshdialleldepltlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfnrgrsatilqylkvplvdratclrstkftiysnmfcagfheggkds
cqgdsggphvtevegtsfltgiiswgeecavkgkygiytkvsryvnwikektklt

SCOPe Domain Coordinates for d1x7ac_:

Click to download the PDB-style file with coordinates for d1x7ac_.
(The format of our PDB-style files is described here.)

Timeline for d1x7ac_: