PDB entry 1x7a

View 1x7a on RCSB PDB site
Description: Porcine Factor IXa Complexed to 1-{3-[amino(imino)methyl]phenyl}-N-[4-(1H-benzimidazol-1-yl)-2-fluorophenyl]-3-(trifluoromethyl)-1H-pyrazole-5-carboxamide
Class: blood clotting,hydrolase
Keywords: inhibition; X-ray structure, blood clotting,hydrolase
Deposited on 2004-08-13, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.216
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Coagulation Factor IXa
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16293 (0-234)
      • see remark 999 (161)
      • see remark 999 (181)
      • see remark 999 (227-234)
    Domains in SCOPe 2.07: d1x7ac_
  • Chain 'L':
    Compound: Coagulation Factor IX, light chain
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x7al1, d1x7al2
  • Heterogens: 187

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x7aC (C:)
    ivggenakpgqfpwqvllngkidafcggsiinekwvvtaahciepgvkitvvageyntee
    tepteqrrnviraiphhsynatvnkyshdialleldepltlnsyvtpiciadkeytnifl
    kfgsgyvsgwgrvfnrgrsatilqylkvplvdratclrstkftiysnmfcagfheggkds
    cqgdsggphvtevegtsfltgiiswgeecavkgkygiytkvsryvnwikektklt
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1x7aL (L:)
    ynsgkleefvrgnlerecieekcsfeearevfentektnefwkqyvdgdqcepnpclngg
    lckddinsyecwcqvgfegknceldatcnikngrckqfcktgadskvlcscttgyrlapd
    qksckpavpfpcgrvsvshspttltr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x7aL (L:)
    qcepnpclngglckddinsyecwcqvgfegknceldatcnikngrckqfcktgadskvlc
    scttgyrlapdqksckpavpfpcgrvsvshspttltr