Lineage for d1pfxc_ (1pfx C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795087Protein Coagulation factor IXa, protease domain [50583] (2 species)
  7. 2795111Species Pig (Sus scrofa) [TaxId:9823] [50584] (2 PDB entries)
  8. 2795112Domain d1pfxc_: 1pfx C: [26353]
    Other proteins in same PDB: d1pfxl1, d1pfxl2, d1pfxl3
    complexed with 0g6

Details for d1pfxc_

PDB Entry: 1pfx (more details), 3 Å

PDB Description: porcine factor ixa
PDB Compounds: (C:) factor ixa

SCOPe Domain Sequences for d1pfxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfxc_ b.47.1.2 (C:) Coagulation factor IXa, protease domain {Pig (Sus scrofa) [TaxId: 9823]}
ivggenakpgqfpwqvllngkidafcggsiinekwvvtaahciepgvkitvvageyntee
tepteqrrnviraiphhsynatvnkyshdialleldepltlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfnrgrsatilqylkvplvdratclrstkftiysnmfcagfheggkds
cqgdsggphvtevegtsfltgiiswgeecavkgkygiytkvsryvnwikektklt

SCOPe Domain Coordinates for d1pfxc_:

Click to download the PDB-style file with coordinates for d1pfxc_.
(The format of our PDB-style files is described here.)

Timeline for d1pfxc_: