Lineage for d1x3zb_ (1x3z B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014464Fold a.189: XPC-binding domain [101237] (1 superfamily)
    4 helices; array
  4. 2014465Superfamily a.189.1: XPC-binding domain [101238] (2 families) (S)
  5. 2014466Family a.189.1.1: XPC-binding domain [101239] (4 protein domains)
  6. 2014478Protein automated matches [190283] (2 species)
    not a true protein
  7. 2014479Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188108] (1 PDB entry)
  8. 2014480Domain d1x3zb_: 1x3z B: [121674]
    Other proteins in same PDB: d1x3za_
    automated match to d1x3wb1
    complexed with suc, zn

Details for d1x3zb_

PDB Entry: 1x3z (more details), 2.8 Å

PDB Description: Structure of a peptide:N-glycanase-Rad23 complex
PDB Compounds: (B:) UV excision repair protein RAD23

SCOPe Domain Sequences for d1x3zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3zb_ a.189.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsigltvedllslrqvvsgnpealapllenisarypqlrehimanpevfvsmlleav

SCOPe Domain Coordinates for d1x3zb_:

Click to download the PDB-style file with coordinates for d1x3zb_.
(The format of our PDB-style files is described here.)

Timeline for d1x3zb_: