SCOPe 2.08: Domain d1x3zb_: 1x3z B:

Lineage for d1x3zb_ (1x3z B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.189: XPC-binding domain-like [101237] (1 superfamily)
   4 helices; array

4. Superfamily a.189.1: XPC-binding domain [101238] (2 families)

5. Family a.189.1.1: XPC-binding domain [101239] (4 proteins)

6. Protein automated matches [190283] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188108] (1 PDB entry)

8. Domain d1x3zb_: 1x3z B: [121674]
   Other proteins in same PDB: d1x3za_
   automated match to d1x3wb1
   complexed with zn

Details for d1x3zb_

PDB Entry: 1x3z, 2.8 Å

PDB Description: structure of a peptide:n-glycanase-rad23 complex

PDB Compounds: (B:) UV excision repair protein RAD23

SCOPe Domain Sequences for d1x3zb_:

Sequence; same for both SEQRES and ATOM records:

>d1x3zb_ a.189.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsigltvedllslrqvvsgnpealapllenisarypqlrehimanpevfvsmlleav

Timeline for d1x3zb_:

• d1x3zb_ first appeared in SCOP 1.73, called d1x3zb1
  
• d1x3zb_ appears in SCOPe 2.07