Lineage for d1x3zb1 (1x3z B:253-309)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 650850Fold a.189: XPC-binding domain [101237] (1 superfamily)
    4 helices; array
  4. 650851Superfamily a.189.1: XPC-binding domain [101238] (1 family) (S)
  5. 650852Family a.189.1.1: XPC-binding domain [101239] (3 proteins)
  6. 650853Protein Rad23 STI1 domain [140601] (1 species)
  7. 650854Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140602] (2 PDB entries)
  8. 650855Domain d1x3zb1: 1x3z B:253-309 [121674]
    Other proteins in same PDB: d1x3za1
    automatically matched to 1X3W B:253-309
    complexed with suc, zn

Details for d1x3zb1

PDB Entry: 1x3z (more details), 2.8 Å

PDB Description: structure of a peptide:n-glycanase-rad23 complex
PDB Compounds: (B:) UV excision repair protein RAD23

SCOP Domain Sequences for d1x3zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x3zb1 a.189.1.1 (B:253-309) Rad23 STI1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsigltvedllslrqvvsgnpealapllenisarypqlrehimanpevfvsmlleav

SCOP Domain Coordinates for d1x3zb1:

Click to download the PDB-style file with coordinates for d1x3zb1.
(The format of our PDB-style files is described here.)

Timeline for d1x3zb1: