PDB entry 1x3z

View 1x3z on RCSB PDB site
Description: Structure of a peptide:N-glycanase-Rad23 complex
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex
Deposited on 2005-05-11, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.237
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptide: N-glycanase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • GB NP_015229 (0-End)
    Domains in SCOPe 2.07: d1x3za_
  • Chain 'B':
    Compound: UV excision repair protein RAD23
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x3zb_
  • Chain 'I':
    Compound: peptide PHQ-Val-Ala-Asp-CF0
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1X3Z (Start-4)
  • Heterogens: SUC, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x3zA (A:)
    nnidfdsiakmllikykdfilskfkkaapvenirfqnlvhtnqfaqgvlgqsqhlctvyd
    npswhsivletldldliyknvdkefakdghaegeniytdylvkellryfkqdffkwcnkp
    dcnhcgqntsenmtplgsqgpngeeskfncgtveiykcnrcgnitrfpryndpiklletr
    kgrcgewcnlftlilksfgldvryvwnredhvwceyfsnflnrwvhvdsceqsfdqpyiy
    sinwnkkmsyciafgkdgvvdvskryilqnelprdqikeedlkflcqfitkrlryslndd
    eiyqlacrdeqeqielirgktqetksesvsaasks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x3zA (A:)
    nnidfdsiakmllikykdfilskfkkaapvenirfqnlvhtnqfaqgvlgqsqhlctvyd
    npswhsivletldldliyknvdkefakdghaegeniytdylvkellryfkqdffkwcnkp
    dcnhcgqntsenmtplgsqgpngeeskfncgtveiykcnrcgnitrfpryndpiklletr
    kgrcgewcnlftlilksfgldvryvwnredhvwceyfsnflnrwvhvdsceqsfdqpyiy
    sinwnkkmsyciafgkdgvvdvskryilqnelprdqikeedlkflcqfitkrlryslndd
    eiyqlacrdeqeqielirgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x3zB (B:)
    gttggatdaaqggppgsigltvedllslrqvvsgnpealapllenisarypqlrehiman
    pevfvsmlleav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x3zB (B:)
    gsigltvedllslrqvvsgnpealapllenisarypqlrehimanpevfvsmlleav
    

  • Chain 'I':
    No sequence available.