SCOPe 2.08: Domain d1x3za_: 1x3z A:

Lineage for d1x3za_ (1x3z A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.4: Transglutaminase core [54044] (3 proteins)

6. Protein automated matches [190634] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188107] (1 PDB entry)

8. Domain d1x3za_: 1x3z A: [121673]
   Other proteins in same PDB: d1x3zb_
   automated match to d1x3wa1
   complexed with zn

Details for d1x3za_

PDB Entry: 1x3z, 2.8 Å

PDB Description: structure of a peptide:n-glycanase-rad23 complex

PDB Compounds: (A:) peptide: N-glycanase

SCOPe Domain Sequences for d1x3za_:

Sequence; same for both SEQRES and ATOM records:

>d1x3za_ d.3.1.4 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nnidfdsiakmllikykdfilskfkkaapvenirfqnlvhtnqfaqgvlgqsqhlctvyd
npswhsivletldldliyknvdkefakdghaegeniytdylvkellryfkqdffkwcnkp
dcnhcgqntsenmtplgsqgpngeeskfncgtveiykcnrcgnitrfpryndpiklletr
kgrcgewcnlftlilksfgldvryvwnredhvwceyfsnflnrwvhvdsceqsfdqpyiy
sinwnkkmsyciafgkdgvvdvskryilqnelprdqikeedlkflcqfitkrlryslndd
eiyqlacrdeqeqielirgk

Timeline for d1x3za_:

• d1x3za_ first appeared in SCOP 1.73, called d1x3za1
  
• d1x3za_ appears in SCOPe 2.07