Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein GTPase Era, N-terminal domain [52637] (2 species) |
Species Thermus thermophilus [TaxId:274] [117533] (2 PDB entries) Uniprot Q5SM23 |
Domain d1x18x1: 1x18 X:4-182 [121577] Other proteins in same PDB: d1x18e1, d1x18f1, d1x18g1, d1x18h1, d1x18x2 automatically matched to d1egaa1 protein/RNA complex |
PDB Entry: 1x18 (more details), 13.5 Å
SCOPe Domain Sequences for d1x18x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x18x1 c.37.1.8 (X:4-182) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe
Timeline for d1x18x1:
View in 3D Domains from other chains: (mouse over for more information) d1x18e1, d1x18f1, d1x18g1, d1x18h1 |