Lineage for d1x18x1 (1x18 X:4-182)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164015Protein GTPase Era, N-terminal domain [52637] (2 species)
  7. 1164020Species Thermus thermophilus [TaxId:274] [117533] (2 PDB entries)
    Uniprot Q5SM23
  8. 1164022Domain d1x18x1: 1x18 X:4-182 [121577]
    Other proteins in same PDB: d1x18e1, d1x18f1, d1x18g1, d1x18h1, d1x18x2
    automatically matched to d1egaa1
    protein/RNA complex

Details for d1x18x1

PDB Entry: 1x18 (more details), 13.5 Å

PDB Description: contact sites of era gtpase on the thermus thermophilus 30s subunit
PDB Compounds: (X:) GTP-binding protein era

SCOPe Domain Sequences for d1x18x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x18x1 c.37.1.8 (X:4-182) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe

SCOPe Domain Coordinates for d1x18x1:

Click to download the PDB-style file with coordinates for d1x18x1.
(The format of our PDB-style files is described here.)

Timeline for d1x18x1: