SCOPe 2.02: Domain d1x18x2: 1x18 X:183-295

Lineage for d1x18x2 (1x18 X:183-295)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein GTPase Era C-terminal domain [54818] (2 species)

7. Species Thermus thermophilus [TaxId:274] [117915] (2 PDB entries)
   Uniprot Q5SM23

8. Domain d1x18x2: 1x18 X:183-295 [121578]
   Other proteins in same PDB: d1x18e1, d1x18f1, d1x18g1, d1x18h1, d1x18x1
   automatically matched to d1egab2
   protein/RNA complex

Details for d1x18x2

PDB Entry: 1x18, 13.5 Å

PDB Description: contact sites of era gtpase on the thermus thermophilus 30s subunit

PDB Compounds: (X:) GTP-binding protein era

SCOPe Domain Sequences for d1x18x2:

Sequence; same for both SEQRES and ATOM records:

>d1x18x2 d.52.3.1 (X:183-295) GTPase Era C-terminal domain {Thermus thermophilus [TaxId: 274]}
dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq
kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrsl

Timeline for d1x18x2:

• d1x18x2 first appeared in SCOP 1.73
  
• d1x18x2 appears in SCOPe 2.01
  
• d1x18x2 appears in SCOPe 2.03
  
• d1x18x2 appears in the current release, SCOPe 2.08