![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein GTPase Era, N-terminal domain [52637] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [117533] (2 PDB entries) Uniprot Q5SM23 |
![]() | Domain d1x18x1: 1x18 X:4-182 [121577] Other proteins in same PDB: d1x18e1, d1x18f1, d1x18g1, d1x18h1, d1x18x2 automatically matched to d1egaa1 protein/RNA complex |
PDB Entry: 1x18 (more details)
SCOPe Domain Sequences for d1x18x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x18x1 c.37.1.8 (X:4-182) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe
Timeline for d1x18x1:
![]() Domains from other chains: (mouse over for more information) d1x18e1, d1x18f1, d1x18g1, d1x18h1 |