SCOPe 2.08: Domain d1x18x1: 1x18 X:4-182

Lineage for d1x18x1 (1x18 X:4-182)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein GTPase Era, N-terminal domain [52637] (3 species)

7. Species Thermus thermophilus [TaxId:274] [117533] (2 PDB entries)
   Uniprot Q5SM23

8. Domain d1x18x1: 1x18 X:4-182 [121577]
   Other proteins in same PDB: d1x18e1, d1x18f1, d1x18g1, d1x18h1, d1x18x2
   automatically matched to d1egaa1
   protein/RNA complex

Details for d1x18x1

PDB Entry: 1x18

PDB Description: contact sites of era gtpase on the thermus thermophilus 30s subunit

PDB Compounds: (X:) GTP-binding protein era

SCOPe Domain Sequences for d1x18x1:

Sequence; same for both SEQRES and ATOM records:

>d1x18x1 c.37.1.8 (X:4-182) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}
dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt
pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav
nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe

Timeline for d1x18x1:

• d1x18x1 first appeared in SCOP 1.73
  
• d1x18x1 appears in SCOPe 2.07