SCOPe 2.08: Domain d1x18h1: 1x18 H:16-88

Lineage for d1x18h1 (1x18 H:16-88)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
   Uniprot P80382

8. Domain d1x18h1: 1x18 H:16-88 [121576]
   Other proteins in same PDB: d1x18e1, d1x18f1, d1x18g1, d1x18x1, d1x18x2
   automatically matched to d1i94r_
   protein/RNA complex

Details for d1x18h1

PDB Entry: 1x18

PDB Description: contact sites of era gtpase on the thermus thermophilus 30s subunit

PDB Compounds: (H:) 30S ribosomal protein S18

SCOPe Domain Sequences for d1x18h1:

Sequence; same for both SEQRES and ATOM records:

>d1x18h1 a.4.8.1 (H:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d1x18h1:

• d1x18h1 first appeared in SCOP 1.73
  
• d1x18h1 appears in SCOPe 2.07