SCOPe 2.02: Domain d1x18e1: 1x18 E:7-240

Lineage for d1x18e1 (1x18 E:7-240)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family)
   fold elaborated with additional structures

5. Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)

6. Protein Ribosomal protein S2 [52315] (3 species)

7. Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries)
   Uniprot P80371

8. Domain d1x18e1: 1x18 E:7-240 [121573]
   Other proteins in same PDB: d1x18f1, d1x18g1, d1x18h1, d1x18x1, d1x18x2
   automatically matched to d1i94b_
   protein/RNA complex

Details for d1x18e1

PDB Entry: 1x18, 13.5 Å

PDB Description: contact sites of era gtpase on the thermus thermophilus 30s subunit

PDB Compounds: (E:) 30S ribosomal protein S2

SCOPe Domain Sequences for d1x18e1:

Sequence; same for both SEQRES and ATOM records:

>d1x18e1 c.23.15.1 (E:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktiqrvhrleelealfaspei
eerpkkeqrlhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvialad
tdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

Timeline for d1x18e1:

• d1x18e1 first appeared in SCOP 1.73
  
• d1x18e1 appears in SCOPe 2.01
  
• d1x18e1 appears in SCOPe 2.03
  
• d1x18e1 appears in the current release, SCOPe 2.08