SCOPe 2.08: Domain d1wzea2: 1wze A:154-332

Lineage for d1wzea2 (1wze A:154-332)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Malate dehydrogenase [56329] (12 species)

7. Species Thermus thermophilus [TaxId:274] [82806] (7 PDB entries)
   identical sequence to that from the Thermus flavus enzyme

8. Domain d1wzea2: 1wze A:154-332 [121496]
   Other proteins in same PDB: d1wzea1, d1wzeb1
   automated match to d1y7ta2
   complexed with nad

Details for d1wzea2

PDB Entry: 1wze, 2 Å

PDB Description: structural basis for alteration of cofactor specificity of malate dehydrogenase from thermus flavus

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1wzea2:

Sequence; same for both SEQRES and ATOM records:

>d1wzea2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewy
ekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygi
pegivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

Timeline for d1wzea2:

• d1wzea2 first appeared in SCOP 1.73
  
• d1wzea2 appears in SCOPe 2.07