Lineage for d1y7ta2 (1y7t A:154-332)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999154Protein Malate dehydrogenase [56329] (12 species)
  7. 2999236Species Thermus thermophilus [TaxId:274] [82806] (7 PDB entries)
    identical sequence to that from the Thermus flavus enzyme
  8. 2999237Domain d1y7ta2: 1y7t A:154-332 [122719]
    Other proteins in same PDB: d1y7ta1, d1y7tb1
    automated match to d1iz9a2
    complexed with ndp, trs

Details for d1y7ta2

PDB Entry: 1y7t (more details), 1.65 Å

PDB Description: Crystal structure of NAD(H)-depenent malate dehydrogenase complexed with NADPH
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1y7ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewy
ekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygi
pegivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

SCOPe Domain Coordinates for d1y7ta2:

Click to download the PDB-style file with coordinates for d1y7ta2.
(The format of our PDB-style files is described here.)

Timeline for d1y7ta2:

2999237
d1y7ta2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1y7ta1