PDB entry 1wze

View 1wze on RCSB PDB site
Description: Structural basis for alteration of cofactor specificity of Malate dehydrogenase from Thermus flavus
Class: oxidoreductase
Keywords: Seven amino acid residues mutant, protein-NADH complex, OXIDOREDUCTASE
Deposited on 2005-03-04, released 2006-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Gene: MDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10584 (0-326)
      • engineered (41-47)
    Domains in SCOPe 2.08: d1wzea1, d1wzea2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Gene: MDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10584 (0-326)
      • engineered (41-47)
    Domains in SCOPe 2.08: d1wzeb1, d1wzeb2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wzeA (A:)
    mkapvrvavtgaagqigysllfriaagemlgkdqpvilqllgsersfqalegvvmeledc
    afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
    kkdvkvlvvgnpantnaliayknapglnprnftamtrldhnrakaqlakktgtgvdrirr
    mtvwgnhsstmfpdlfhaevdgrpalelvdmewyekvfiptvaqrgaaiiqargassaas
    aanaaiehirdwalgtpegdwvsmavpsqgeygipegivysfpvtakdgayrvveglein
    efarkrmeitaqelldemeqvkalgli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wzeB (B:)
    mkapvrvavtgaagqigysllfriaagemlgkdqpvilqllgsersfqalegvvmeledc
    afpllagleatddpkvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
    kkdvkvlvvgnpantnaliayknapglnprnftamtrldhnrakaqlakktgtgvdrirr
    mtvwgnhsstmfpdlfhaevdgrpalelvdmewyekvfiptvaqrgaaiiqargassaas
    aanaaiehirdwalgtpegdwvsmavpsqgeygipegivysfpvtakdgayrvveglein
    efarkrmeitaqelldemeqvkalgli