Lineage for d1wyuf1 (1wyu F:2-472)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 706155Family c.67.1.7: Glycine dehydrogenase subunits (GDC-P) [142678] (2 proteins)
    Pfam PF02347
  6. 706168Protein Glycine dehydrogenase subunit 2 (P-protein) [142681] (1 species)
  7. 706169Species Thermus thermophilus [TaxId:274] [142682] (3 PDB entries)
  8. 706172Domain d1wyuf1: 1wyu F:2-472 [121457]
    Other proteins in same PDB: d1wyua1, d1wyuc1, d1wyue1, d1wyug1
    automatically matched to 1WYT B:2-472
    complexed with plp

Details for d1wyuf1

PDB Entry: 1wyu (more details), 2.1 Å

PDB Description: Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in holo form
PDB Compounds: (F:) glycine dehydrogenase subunit 2 (P-protein)

SCOP Domain Sequences for d1wyuf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyuf1 c.67.1.7 (F:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]}
sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfd

SCOP Domain Coordinates for d1wyuf1:

Click to download the PDB-style file with coordinates for d1wyuf1.
(The format of our PDB-style files is described here.)

Timeline for d1wyuf1: