![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.67: PLP-dependent transferases [53382] (1 superfamily) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) ![]() |
![]() | Family c.67.1.7: Glycine dehydrogenase subunits (GDC-P) [142678] (2 proteins) Pfam PF02347 |
![]() | Protein Glycine dehydrogenase subunit 2 (P-protein) [142681] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [142682] (3 PDB entries) |
![]() | Domain d1wyub1: 1wyu B:2-472 [121453] Other proteins in same PDB: d1wyua1, d1wyuc1, d1wyue1, d1wyug1 automatically matched to 1WYT B:2-472 complexed with plp |
PDB Entry: 1wyu (more details), 2.1 Å
SCOP Domain Sequences for d1wyub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfd
Timeline for d1wyub1: