Lineage for d1wyug1 (1wyu G:1-437)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 706155Family c.67.1.7: Glycine dehydrogenase subunits (GDC-P) [142678] (2 proteins)
    Pfam PF02347
  6. 706156Protein Glycine dehydrogenase (decarboxylating) subunit 1 [142679] (1 species)
  7. 706157Species Thermus thermophilus [TaxId:274] [142680] (3 PDB entries)
  8. 706161Domain d1wyug1: 1wyu G:1-437 [121458]
    Other proteins in same PDB: d1wyub1, d1wyud1, d1wyuf1, d1wyuh1
    automatically matched to 1WYT A:1-437
    complexed with plp

Details for d1wyug1

PDB Entry: 1wyu (more details), 2.1 Å

PDB Description: Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in holo form
PDB Compounds: (G:) glycine dehydrogenase (decarboxylating) subunit 1

SCOP Domain Sequences for d1wyug1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyug1 c.67.1.7 (G:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]}
mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
heeedllalrealkevl

SCOP Domain Coordinates for d1wyug1:

Click to download the PDB-style file with coordinates for d1wyug1.
(The format of our PDB-style files is described here.)

Timeline for d1wyug1: