Lineage for d1wyuf_ (1wyu F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896611Family c.67.1.7: Glycine dehydrogenase subunits (GDC-P) [142678] (2 proteins)
    Pfam PF02347
  6. 2896624Protein Glycine dehydrogenase subunit 2 (P-protein) [142681] (1 species)
  7. 2896625Species Thermus thermophilus [TaxId:274] [142682] (3 PDB entries)
    Uniprot Q5SKW7 2-472
  8. 2896628Domain d1wyuf_: 1wyu F: [121457]
    Other proteins in same PDB: d1wyua_, d1wyuc_, d1wyue_, d1wyug_
    automated match to d1wytb1
    complexed with plp

Details for d1wyuf_

PDB Entry: 1wyu (more details), 2.1 Å

PDB Description: Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in holo form
PDB Compounds: (F:) glycine dehydrogenase subunit 2 (P-protein)

SCOPe Domain Sequences for d1wyuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyuf_ c.67.1.7 (F:) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]}
sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg

SCOPe Domain Coordinates for d1wyuf_:

Click to download the PDB-style file with coordinates for d1wyuf_.
(The format of our PDB-style files is described here.)

Timeline for d1wyuf_: