PDB entry 1wyu

View 1wyu on RCSB PDB site
Description: Crystal structure of glycine decarboxylase (P-protein) of the glycine cleavage system, in holo form
Class: oxidoreductase
Keywords: ALPHA(2)BETA(2) TETRAMER, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2005-02-17, released 2005-04-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-06-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine dehydrogenase (decarboxylating) subunit 1
    Species: Thermus thermophilus
    Gene: GCSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wyua1
  • Chain 'B':
    Compound: glycine dehydrogenase subunit 2 (P-protein)
    Species: Thermus thermophilus
    Gene: GCSB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wyub1
  • Chain 'C':
    Compound: glycine dehydrogenase (decarboxylating) subunit 1
    Species: Thermus thermophilus
    Gene: GCSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wyuc1
  • Chain 'D':
    Compound: glycine dehydrogenase subunit 2 (P-protein)
    Species: Thermus thermophilus
    Gene: GCSB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wyud1
  • Chain 'E':
    Compound: glycine dehydrogenase (decarboxylating) subunit 1
    Species: Thermus thermophilus
    Gene: GCSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wyue1
  • Chain 'F':
    Compound: glycine dehydrogenase subunit 2 (P-protein)
    Species: Thermus thermophilus
    Gene: GCSB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wyuf1
  • Chain 'G':
    Compound: glycine dehydrogenase (decarboxylating) subunit 1
    Species: Thermus thermophilus
    Gene: GCSA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wyug1
  • Chain 'H':
    Compound: glycine dehydrogenase subunit 2 (P-protein)
    Species: Thermus thermophilus
    Gene: GCSB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wyuh1
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wyuA (A:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyuA (A:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wyuB (B:)
    msfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrr
    qvgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkalt
    gmdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqv
    reipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydg
    anlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverg
    eegfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkell
    kekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmvepte
    teaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyuB (B:)
    sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
    vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
    mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
    eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
    nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
    egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
    ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
    eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wyuC (C:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyuC (C:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wyuD (D:)
    msfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrr
    qvgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkalt
    gmdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqv
    reipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydg
    anlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverg
    eegfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkell
    kekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmvepte
    teaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyuD (D:)
    sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
    vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
    mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
    eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
    nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
    egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
    ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
    eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wyuE (E:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyuE (E:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wyuF (F:)
    msfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrr
    qvgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkalt
    gmdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqv
    reipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydg
    anlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverg
    eegfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkell
    kekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmvepte
    teaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyuF (F:)
    sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
    vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
    mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
    eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
    nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
    egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
    ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
    eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1wyuG (G:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyuG (G:)
    mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvleelrrlaaq
    nlpahkaflgggvrshhvppvvqalaargefltaytpyqpevsqgvlqatfeyqtmiael
    agleianasmydgatalaegvllalretgrmgvlvsqgvhpeyravlrayleavgakllt
    lpleggrtplpevgeevgavvvqnpnflgaledlgpfaeaahgagalfvavadplslgvl
    kppgaygadiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfi
    ltlqareqyirrakaksnittnaqltalmgamylaalgpeglrevalksvemahklhall
    levpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatel
    heeedllalrealkevl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1wyuH (H:)
    msfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrr
    qvgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkalt
    gmdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqv
    reipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydg
    anlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverg
    eegfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkell
    kekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmvepte
    teaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wyuH (H:)
    sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrq
    vgvdttfyplgsctmkynpklheeaarlfadlhpyqdprtaqgalrlmwelgeylkaltg
    mdaitlepaagahgeltgiliirayhedrgegrtrrvvlvpdsahgsnpatasmagyqvr
    eipsgpegevdlealkrelgphvaalmltnpntlglferrileisrlckeagvqlyydga
    nlnaimgwarpgdmgfdvvhlnlhktftvphggggpgsgpvgvkahlapylpvplverge
    egfyldfdrpksigrvrsfygnflalvrawayirtlgleglkkaaalavlnarylkellk
    ekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmveptet
    eaketleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfdeg