Lineage for d1wrba1 (1wrb A:164-401)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113231Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 protein domains)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2113368Protein putative ATP-dependent RNA helicase VlgB [142306] (1 species)
  7. 2113369Species Flatworm (Dugesia japonica) [TaxId:6161] [142307] (1 PDB entry)
    Uniprot O97032 164-401
  8. 2113370Domain d1wrba1: 1wrb A:164-401 [121192]
    Other proteins in same PDB: d1wrbb_
    C-terminal domain
    complexed with so4

Details for d1wrba1

PDB Entry: 1wrb (more details), 2.4 Å

PDB Description: Crystal structure of the N-terminal RecA-like domain of DjVLGB, a pranarian Vasa-like RNA helicase
PDB Compounds: (A:) DjVLGB

SCOPe Domain Sequences for d1wrba1:

Sequence, based on SEQRES records: (download)

>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}
kydsipvsvtgpdysatnvienfdelkldptirnnillasyqrptpiqknaipailehrd
imacaqtgsgktaaflipiinhlvcqdlnqqrysktaypkclilaptrelaiqilsesqk
fslntplrscvvyggadthsqirevqmgchllvatpgrlvdfieknkislefckyivlde
adrmldmgfepqirkiieesnmpsginrqtlmfsatfpkeiqklaadflynyifmtvg

Sequence, based on observed residues (ATOM records): (download)

>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}
kydsipvsvtgpdysatnvienfdelkldptirnnillasyqrptpiqknaipailehrd
imacaqtgsgktaaflipiinhlvcqdlktaypkclilaptrelaiqilsesqkfslntp
lrscvvyggadthsqirevqmgchllvatpgrlvdfieknkislefckyivldeadrmld
mgfepqirkiieesnmpsginrqtlmfsatfpkeiqklaadflynyifmtvg

SCOPe Domain Coordinates for d1wrba1:

Click to download the PDB-style file with coordinates for d1wrba1.
(The format of our PDB-style files is described here.)

Timeline for d1wrba1: