PDB entry 1wrb

View 1wrb on RCSB PDB site
Description: Crystal structure of the N-terminal RecA-like domain of DjVLGB, a pranarian Vasa-like RNA helicase
Class: hydrolase
Keywords: RNA HELICASE, DEAD BOX, VASA, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2004-10-14, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.241
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DjVLGB
    Species: Dugesia japonica [TaxId:6161]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wrba1
  • Chain 'B':
    Compound: DjVLGB
    Species: Dugesia japonica [TaxId:6161]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wrbb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wrbA (A:)
    fdkydsipvsvtgpdysatnvienfdelkldptirnnillasyqrptpiqknaipaileh
    rdimacaqtgsgktaaflipiinhlvcqdlnqqrysktaypkclilaptrelaiqilses
    qkfslntplrscvvyggadthsqirevqmgchllvatpgrlvdfieknkislefckyivl
    deadrmldmgfepqirkiieesnmpsginrqtlmfsatfpkeiqklaadflynyifmtvg
    rvgstsdsikqei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrbA (A:)
    kydsipvsvtgpdysatnvienfdelkldptirnnillasyqrptpiqknaipailehrd
    imacaqtgsgktaaflipiinhlvcqdlktaypkclilaptrelaiqilsesqkfslntp
    lrscvvyggadthsqirevqmgchllvatpgrlvdfieknkislefckyivldeadrmld
    mgfepqirkiieesnmpsginrqtlmfsatfpkeiqklaadflynyifmtvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wrbB (B:)
    fdkydsipvsvtgpdysatnvienfdelkldptirnnillasyqrptpiqknaipaileh
    rdimacaqtgsgktaaflipiinhlvcqdlnqqrysktaypkclilaptrelaiqilses
    qkfslntplrscvvyggadthsqirevqmgchllvatpgrlvdfieknkislefckyivl
    deadrmldmgfepqirkiieesnmpsginrqtlmfsatfpkeiqklaadflynyifmtvg
    rvgstsdsikqei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wrbB (B:)
    sipvsvtgpdysatnvienfdelkldptirnnillasyqrptpiqknaipailehrdima
    caqtgsgktaaflipiinhlvcqdlysktaypkclilaptrelaiqilsesqkfslntpl
    rscvvyggadthsqirevqmgchllvatpgrlvdfieknkislefckyivldeadrmldm
    gfepqirkiieesnmpsginrqtlmfsatfpkeiqklaadflynyifmtvgr