Lineage for d1wrbb_ (1wrb B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113231Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 protein domains)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2113438Protein automated matches [190301] (5 species)
    not a true protein
  7. 2113442Species Flatworm (Dugesia japonica) [TaxId:6161] [188089] (1 PDB entry)
  8. 2113443Domain d1wrbb_: 1wrb B: [121193]
    Other proteins in same PDB: d1wrba1
    automated match to d1wrba1
    complexed with so4

Details for d1wrbb_

PDB Entry: 1wrb (more details), 2.4 Å

PDB Description: Crystal structure of the N-terminal RecA-like domain of DjVLGB, a pranarian Vasa-like RNA helicase
PDB Compounds: (B:) DjVLGB

SCOPe Domain Sequences for d1wrbb_:

Sequence, based on SEQRES records: (download)

>d1wrbb_ c.37.1.19 (B:) automated matches {Flatworm (Dugesia japonica) [TaxId: 6161]}
sipvsvtgpdysatnvienfdelkldptirnnillasyqrptpiqknaipailehrdima
caqtgsgktaaflipiinhlvcqdlnqqrysktaypkclilaptrelaiqilsesqkfsl
ntplrscvvyggadthsqirevqmgchllvatpgrlvdfieknkislefckyivldeadr
mldmgfepqirkiieesnmpsginrqtlmfsatfpkeiqklaadflynyifmtvgr

Sequence, based on observed residues (ATOM records): (download)

>d1wrbb_ c.37.1.19 (B:) automated matches {Flatworm (Dugesia japonica) [TaxId: 6161]}
sipvsvtgpdysatnvienfdelkldptirnnillasyqrptpiqknaipailehrdima
caqtgsgktaaflipiinhlvcqdlysktaypkclilaptrelaiqilsesqkfslntpl
rscvvyggadthsqirevqmgchllvatpgrlvdfieknkislefckyivldeadrmldm
gfepqirkiieesnmpsginrqtlmfsatfpkeiqklaadflynyifmtvgr

SCOPe Domain Coordinates for d1wrbb_:

Click to download the PDB-style file with coordinates for d1wrbb_.
(The format of our PDB-style files is described here.)

Timeline for d1wrbb_: