![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
![]() | Protein Syntenin 1 [89311] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries) |
![]() | Domain d1w9oa2: 1w9o A:195-273 [120788] Other proteins in same PDB: d1w9oa3, d1w9ob3 automated match to d1obza2 complexed with bez |
PDB Entry: 1w9o (more details), 2.25 Å
SCOPe Domain Sequences for d1w9oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w9oa2 b.36.1.1 (A:195-273) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} fertitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqi adilstsgtvvtitimpaf
Timeline for d1w9oa2: