Lineage for d1obza2 (1obz A:195-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786178Protein Syntenin 1 [89311] (1 species)
  7. 2786179Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)
  8. 2786192Domain d1obza2: 1obz A:195-273 [86787]
    Other proteins in same PDB: d1obza3, d1obzb3
    tandem of two PDZ domains; complexed with an interleukin 5 receptor alpha peptide, chain P
    complexed with act

Details for d1obza2

PDB Entry: 1obz (more details), 1.7 Å

PDB Description: crystal structure of the complex of the pdz tandem of syntenin with an interleukin 5 receptor alpha peptide.
PDB Compounds: (A:) Syntenin 1

SCOPe Domain Sequences for d1obza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obza2 b.36.1.1 (A:195-273) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
fertitmhkdstghvgfifkngkitsivkdssaarnglltehniceingqnviglkdsqi
adilstsgtvvtitimpaf

SCOPe Domain Coordinates for d1obza2:

Click to download the PDB-style file with coordinates for d1obza2.
(The format of our PDB-style files is described here.)

Timeline for d1obza2: