PDB entry 1w9o

View 1w9o on RCSB PDB site
Description: Crystal structure of the PDZ tandem of human syntenin in complex with TNEYYV peptide
Class: cell adhesion
Keywords: cell adhesion, adhesion-complex, pdz domain, scaffolding protein
Deposited on 2004-10-15, released 2006-03-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Syntenin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SDCBP, MDA9, SYCL
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9O (Start-4)
    • Uniprot O00560 (5-165)
    Domains in SCOPe 2.08: d1w9oa1, d1w9oa2, d1w9oa3
  • Chain 'B':
    Compound: Syntenin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SDCBP, MDA9, SYCL
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9O (Start-4)
    • Uniprot O00560 (5-End)
    Domains in SCOPe 2.08: d1w9ob1, d1w9ob2, d1w9ob3
  • Chain 'S':
    Compound: tneyyv peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9O (Start-5)
  • Chain 'T':
    Compound: tneyyv peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9O (Start-5)
  • Heterogens: BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w9oA (A:)
    gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
    gwssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssa
    arnglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9oA (A:)
    mdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagw
    ssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssaar
    nglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w9oB (B:)
    gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
    gwssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssa
    arnglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9oB (B:)
    mdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagw
    ssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssaar
    nglltehniceingqnviglkdsqiadilstsgtvvtitimpa
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.