Lineage for d1w9ob1 (1w9o B:113-194)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786178Protein Syntenin 1 [89311] (1 species)
  7. 2786179Species Human (Homo sapiens) [TaxId:9606] [89312] (11 PDB entries)
  8. 2786207Domain d1w9ob1: 1w9o B:113-194 [120789]
    Other proteins in same PDB: d1w9oa3, d1w9ob3
    automated match to d1obzb1
    complexed with bez

Details for d1w9ob1

PDB Entry: 1w9o (more details), 2.25 Å

PDB Description: crystal structure of the pdz tandem of human syntenin in complex with tneyyv peptide
PDB Compounds: (B:) Syntenin 1

SCOPe Domain Sequences for d1w9ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w9ob1 b.36.1.1 (B:113-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]}
revilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagwssd
kahkvlkqafgekitmtirdrp

SCOPe Domain Coordinates for d1w9ob1:

Click to download the PDB-style file with coordinates for d1w9ob1.
(The format of our PDB-style files is described here.)

Timeline for d1w9ob1: