SCOPe 2.08: Domain d1vr5a1: 1vr5 A:23-557

Lineage for d1vr5a1 (1vr5 A:23-557)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Oligo-peptide binding protein (OPPA) [53852] (3 species)
   contains an additional alpha+beta domain inserted in the N-terminal domain

7. Species Thermotoga maritima [TaxId:2336] [142800] (3 PDB entries)
   Uniprot Q9X0V0 23-557
   TM1223

8. Domain d1vr5a1: 1vr5 A:23-557 [120437]
   Other proteins in same PDB: d1vr5a2, d1vr5b3
   complexed with act, cl, edo, epe, fmt, na
   has additional subdomain(s) that are not in the common domain

Details for d1vr5a1

PDB Entry: 1vr5, 1.73 Å

PDB Description: crystal structure of oligopeptide abc transporter, periplasmic oligopeptide-binding (tm1223) from thermotoga maritima at 1.73 a resolution

PDB Compounds: (A:) oligopeptide ABC transporter, periplasmic oligopeptide-binding protein

SCOPe Domain Sequences for d1vr5a1:

Sequence; same for both SEQRES and ATOM records:

>d1vr5a1 c.94.1.1 (A:23-557) Oligo-peptide binding protein (OPPA) {Thermotoga maritima [TaxId: 2336]}
ernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekgewv
snneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervdertlk
fvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpyyveswaddrcvf
kkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnfflpgvpvlkkaygi
vtwyenapymlpantagiyinvnkyplsipefrramayainpekivtrayenmvtaanpa
gilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfredpngkpfkltie
cpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnfttgvsati
wsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklseillk
dlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieak

Timeline for d1vr5a1:

• d1vr5a1 first appeared in SCOP 1.73
  
• d1vr5a1 appears in SCOPe 2.07