PDB entry 1vr5

View 1vr5 on RCSB PDB site
Description: Crystal structure of Oligopeptide ABC transporter, periplasmic oligopeptide-binding (TM1223) from THERMOTOGA MARITIMA at 1.73 A resolution
Class: protein transport
Keywords: TM1223, OLIGOPEPTIDE ABC TRANSPORTER, PERIPLASMIC OLIGOPEPTIDE-BINDING, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, PROTEIN TRANSPORT
Deposited on 2005-02-11, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oligopeptide ABC transporter, periplasmic oligopeptide-binding protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1223
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0V0 (12-546)
      • leader sequence (11)
      • modified residue (145)
      • modified residue (226)
      • modified residue (228)
      • modified residue (261)
      • modified residue (287)
      • modified residue (304)
      • modified residue (320)
      • modified residue (339)
      • modified residue (380)
    Domains in SCOPe 2.07: d1vr5a1, d1vr5a2
  • Chain 'B':
    Compound: oligopeptide ABC transporter, periplasmic oligopeptide-binding protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1223
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0V0 (12-546)
      • leader sequence (11)
      • modified residue (145)
      • modified residue (226)
      • modified residue (228)
      • modified residue (261)
      • modified residue (287)
      • modified residue (304)
      • modified residue (320)
      • modified residue (339)
      • modified residue (380)
    Domains in SCOPe 2.07: d1vr5b2, d1vr5b3
  • Heterogens: NA, CL, ACT, EPE, EDO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vr5A (A:)
    mgsdkihhhhhhernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndk
    fepwlaekgewvsnneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwl
    griervdertlkfvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpy
    yveswaddrcvfkkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnffl
    pgvpvlkkaygivtwyenapymlpantagiyinvnkyplsipefrramayainpekivtr
    ayenmvtaanpagilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfre
    dpngkpfkltiecpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdli
    lnnfttgvsatiwsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakik
    evvaklseillkdlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgikt
    lfgieak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr5A (A:)
    hernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekgew
    vsnneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervdertl
    kfvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpyyveswaddrcv
    fkkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnfflpgvpvlkkayg
    ivtwyenapymlpantagiyinvnkyplsipefrramayainpekivtrayenmvtaanp
    agilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfredpngkpfklti
    ecpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnfttgvsat
    iwsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklseill
    kdlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vr5B (B:)
    mgsdkihhhhhhernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndk
    fepwlaekgewvsnneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwl
    griervdertlkfvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpy
    yveswaddrcvfkkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnffl
    pgvpvlkkaygivtwyenapymlpantagiyinvnkyplsipefrramayainpekivtr
    ayenmvtaanpagilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfre
    dpngkpfkltiecpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdli
    lnnfttgvsatiwsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakik
    evvaklseillkdlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgikt
    lfgieak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vr5B (B:)
    hernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekgew
    vsnneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervdertl
    kfvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpyyveswaddrcv
    fkkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnfflpgvpvlkkayg
    ivtwyenapymlpantagiyinvnkyplsipefrramayainpekivtrayenmvtaanp
    agilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfredpngkpfklti
    ecpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnfttgvsat
    iwsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklseill
    kdlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieak