Lineage for d1vr5b2 (1vr5 B:23-557)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914521Protein Oligo-peptide binding protein (OPPA) [53852] (3 species)
    contains an additional alpha+beta domain inserted in the N-terminal domain
  7. 2914558Species Thermotoga maritima [TaxId:2336] [142800] (3 PDB entries)
    Uniprot Q9X0V0 23-557
    TM1223
  8. 2914564Domain d1vr5b2: 1vr5 B:23-557 [120438]
    Other proteins in same PDB: d1vr5a2, d1vr5b3
    automated match to d1vr5a1
    complexed with act, cl, edo, epe, fmt, na

    has additional subdomain(s) that are not in the common domain

Details for d1vr5b2

PDB Entry: 1vr5 (more details), 1.73 Å

PDB Description: crystal structure of oligopeptide abc transporter, periplasmic oligopeptide-binding (tm1223) from thermotoga maritima at 1.73 a resolution
PDB Compounds: (B:) oligopeptide ABC transporter, periplasmic oligopeptide-binding protein

SCOPe Domain Sequences for d1vr5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vr5b2 c.94.1.1 (B:23-557) Oligo-peptide binding protein (OPPA) {Thermotoga maritima [TaxId: 2336]}
ernktlywggalwsppsnwnpftpwnavagtiglvyeplflydplndkfepwlaekgewv
snneyvltlrkglrwqdgvpltaddvvftfeiakkytgisyspvwnwlgriervdertlk
fvfsdpryqewkqmlintpivpkhiwenkteeevlqaanenpvgsgpyyveswaddrcvf
kkngnwwgirelgydpkperivelrvlsnnvavgmlmkgeldwsnfflpgvpvlkkaygi
vtwyenapymlpantagiyinvnkyplsipefrramayainpekivtrayenmvtaanpa
gilplpgymkyypkevvdkygfkydpemakkildelgfkdvnkdgfredpngkpfkltie
cpygwtdwmvsiqsiaedlvkvginvepkypdyskyaddlyggkfdlilnnfttgvsati
wsyfngvfypdaveseysysgnfgkyanpevetlldelnrsnddakikevvaklseillk
dlpfiplwyngawfqaseavwtnwpteknpyavpigwngwwqltgiktlfgieak

SCOPe Domain Coordinates for d1vr5b2:

Click to download the PDB-style file with coordinates for d1vr5b2.
(The format of our PDB-style files is described here.)

Timeline for d1vr5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vr5b3