![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
![]() | Protein automated matches [190081] (33 species) not a true protein |
![]() | Species Agrobacterium tumefaciens [TaxId:176299] [186802] (1 PDB entry) |
![]() | Domain d1vqyb2: 1vqy B:1-104 [120419] Other proteins in same PDB: d1vqya1, d1vqya2, d1vqyb3, d1vqyc3, d1vqyf3, d1vqyg3, d1vqyh3 automated match to d1vqsa_ complexed with po4 |
PDB Entry: 1vqy (more details), 2.4 Å
SCOPe Domain Sequences for d1vqyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqyb2 d.58.4.0 (B:1-104) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
Timeline for d1vqyb2: