SCOPe 2.08: Domain d1vqyg2: 1vqy G:1-104

Lineage for d1vqyg2 (1vqy G:1-104)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [186802] (1 PDB entry)

8. Domain d1vqyg2: 1vqy G:1-104 [120424]
   Other proteins in same PDB: d1vqya1, d1vqya2, d1vqyb3, d1vqyc3, d1vqyf3, d1vqyg3, d1vqyh3
   automated match to d1vqsa_
   complexed with po4

Details for d1vqyg2

PDB Entry: 1vqy, 2.4 Å

PDB Description: crystal structure of a nipsnap family protein (atu5224) from agrobacterium tumefaciens str. c58 at 2.40 a resolution

PDB Compounds: (G:) hypothetical protein AGR_pAT_315

SCOPe Domain Sequences for d1vqyg2:

Sequence; same for both SEQRES and ATOM records:

>d1vqyg2 d.58.4.0 (G:1-104) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl
ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr

Timeline for d1vqyg2:

• d1vqyg2 first appeared in SCOP 1.73, called d1vqyg1
  
• d1vqyg2 appears in SCOPe 2.07