Lineage for d1vqyg2 (1vqy G:1-104)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. Protein automated matches [190081] (32 species)
    not a true protein
  7. Species Agrobacterium tumefaciens [TaxId:176299] [186802] (1 PDB entry)
  8. Domain d1vqyg2: 1vqy G:1-104 [120424]
    Other proteins in same PDB: d1vqya1, d1vqya2, d1vqyb3, d1vqyc3, d1vqyf3, d1vqyg3, d1vqyh3
    automated match to d1vqsa_
    complexed with po4

Details for d1vqyg2

PDB Entry: 1vqy (more details), 2.4 Å

PDB Description: crystal structure of a nipsnap family protein (atu5224) from agrobacterium tumefaciens str. c58 at 2.40 a resolution
PDB Compounds: (G:) hypothetical protein AGR_pAT_315

SCOPe Domain Sequences for d1vqyg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqyg2 d.58.4.0 (G:1-104) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl
ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr

SCOPe Domain Coordinates for d1vqyg2 are not available.

Timeline for d1vqyg2:

Domains from same chain:
(mouse over for more information)
d1vqyg3
Domains from other chains:
(mouse over for more information)
d1vqya1, d1vqya2, d1vqyb2, d1vqyb3, d1vqyc2, d1vqyc3, d1vqyd_, d1vqye_, d1vqyf2, d1vqyf3, d1vqyh2, d1vqyh3