![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.13: NIPSNAP [117943] (2 proteins) Pfam PF07978 |
![]() | Protein Hypothetical protein Atu5224 [143263] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [143264] (1 PDB entry) Uniprot Q8UK99 1-104 |
![]() | Domain d1vqya1: 1vqy A:1-104 [120418] Other proteins in same PDB: d1vqya2, d1vqyb2, d1vqyb3, d1vqyc2, d1vqyc3, d1vqyd_, d1vqye_, d1vqyf2, d1vqyf3, d1vqyg2, d1vqyg3, d1vqyh2, d1vqyh3 complexed with po4 |
PDB Entry: 1vqy (more details), 2.4 Å
SCOPe Domain Sequences for d1vqya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqya1 d.58.4.13 (A:1-104) Hypothetical protein Atu5224 {Agrobacterium tumefaciens [TaxId: 358]} miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
Timeline for d1vqya1: