SCOPe 2.08: Domain d1vqya1: 1vqy A:1-104

Lineage for d1vqya1 (1vqy A:1-104)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.13: NIPSNAP [117943] (2 proteins)
Pfam PF07978
Protein Hypothetical protein Atu5224 [143263] (1 species)
Species Agrobacterium tumefaciens [TaxId:358] [143264] (1 PDB entry)
Uniprot Q8UK99 1-104
Domain d1vqya1: 1vqy A:1-104 [120418]
Other proteins in same PDB: d1vqya2, d1vqyb2, d1vqyb3, d1vqyc2, d1vqyc3, d1vqyd_, d1vqye_, d1vqyf2, d1vqyf3, d1vqyg2, d1vqyg3, d1vqyh2, d1vqyh3
complexed with po4

Details for d1vqya1

PDB Entry: 1vqy (more details), 2.4 Å

PDB Description: crystal structure of a nipsnap family protein (atu5224) from agrobacterium tumefaciens str. c58 at 2.40 a resolution

PDB Compounds: (A:) hypothetical protein AGR_pAT_315

SCOPe Domain Sequences for d1vqya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqya1 d.58.4.13 (A:1-104) Hypothetical protein Atu5224 {Agrobacterium tumefaciens [TaxId: 358]}
miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl
ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr

SCOPe Domain Coordinates for d1vqya1:

Click to download the PDB-style file with coordinates for d1vqya1.
(The format of our PDB-style files is described here.)

Timeline for d1vqya1: