PDB entry 1vqy

View 1vqy on RCSB PDB site
Description: CRYSTAL STRUCTURE OF a NIPSNAP FAMILY PROTEIN (ATU5224) FROM AGROBACTERIUM TUMEFACIENS STR. C58 AT 2.40 A RESOLUTION
Class: unknown function
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, unknown function
Deposited on 2005-01-07, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOPe 2.07: d1vqya1, d1vqya2
  • Chain 'B':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • leader sequence (2-11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOPe 2.07: d1vqyb2, d1vqyb3
  • Chain 'C':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOPe 2.07: d1vqyc2, d1vqyc3
  • Chain 'D':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOPe 2.07: d1vqyd_
  • Chain 'E':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOPe 2.07: d1vqye_
  • Chain 'F':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOPe 2.07: d1vqyf2, d1vqyf3
  • Chain 'G':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOPe 2.07: d1vqyg2, d1vqyg3
  • Chain 'H':
    Compound: hypothetical protein AGR_pAT_315
    Species: Agrobacterium tumefaciens str. C58 [TaxId:176299]
    Gene: AGR_pAT_315
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UK99 (12-115)
      • leader sequence (11)
      • modified residue (12)
      • modified residue (26)
      • modified residue (65)
    Domains in SCOPe 2.07: d1vqyh2, d1vqyh3
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vqyA (A:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyA (A:)
    hmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyas
    lddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vqyB (B:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyB (B:)
    sdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsq
    vihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vqyC (C:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyC (C:)
    hmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyas
    lddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vqyD (D:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyD (D:)
    miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl
    ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vqyE (E:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyE (E:)
    miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl
    ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vqyF (F:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyF (F:)
    hmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyas
    lddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1vqyG (G:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyG (G:)
    hmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyas
    lddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1vqyH (H:)
    mgsdkihhhhhhmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigpl
    sqvihmwgyaslddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vqyH (H:)
    hmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyas
    lddraerrgklaedqrwqafiprlsvliessenrillptdfsplr