SCOP 1.73: Domain d1vqkp1: 1vqk P:1-143

Lineage for d1vqkp1 (1vqk P:1-143)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
   multihelical; consists of two different 3-helical domains connected by a long, partly helical linker

4. Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family)

5. Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)

6. Protein Ribosomal protein L19 (L19e) [48142] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (40 PDB entries)

8. Domain d1vqkp1: 1vqk P:1-143 [120261]
   Other proteins in same PDB: d1vqk11, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1
   automatically matched to d1s72p_
   complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sr, ur3

Details for d1vqkp1

PDB Entry: 1vqk, 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui

PDB Compounds: (P:) 50S ribosomal protein L19e

SCOP Domain Sequences for d1vqkp1:

Sequence; same for both SEQRES and ATOM records:

>d1vqkp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

Timeline for d1vqkp1:

• d1vqkp1 is new in SCOP 1.73
  
• d1vqkp1 appears in SCOP 1.75
  
• d1vqkp1 appears in the current release, SCOPe 2.08